Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1239421..1239989 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | M7V54_RS05955 | Protein ID | WP_003405865.1 |
| Coordinates | 1239615..1239989 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | M7V54_RS05950 | Protein ID | WP_003405863.1 |
| Coordinates | 1239421..1239618 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS05930 | 1235462..1236100 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| M7V54_RS05935 | 1236190..1237197 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| M7V54_RS05940 | 1237214..1238197 | - | 984 | WP_003898731.1 | hypothetical protein | - |
| M7V54_RS05945 | 1238260..1239333 | + | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
| M7V54_RS05950 | 1239421..1239618 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M7V54_RS05955 | 1239615..1239989 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M7V54_RS05960 | 1240192..1240890 | + | 699 | WP_003898733.1 | hypothetical protein | - |
| M7V54_RS05965 | 1241008..1241193 | + | 186 | WP_003901093.1 | hypothetical protein | - |
| M7V54_RS05970 | 1241120..1241395 | - | 276 | WP_003405867.1 | hypothetical protein | - |
| M7V54_RS05975 | 1241638..1241961 | + | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
| M7V54_RS05980 | 1241976..1242674 | - | 699 | WP_031646953.1 | hypothetical protein | - |
| M7V54_RS05985 | 1242708..1242917 | + | 210 | WP_003911400.1 | hypothetical protein | - |
| M7V54_RS05990 | 1242869..1243639 | - | 771 | Protein_1180 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T263988 WP_003405865.1 NZ_CP110619:1239615-1239989 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|