Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1239421..1239989 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag M7V54_RS05955 Protein ID WP_003405865.1
Coordinates 1239615..1239989 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag M7V54_RS05950 Protein ID WP_003405863.1
Coordinates 1239421..1239618 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS05930 1235462..1236100 - 639 WP_003898730.1 lipid droplet-associated protein -
M7V54_RS05935 1236190..1237197 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
M7V54_RS05940 1237214..1238197 - 984 WP_003898731.1 hypothetical protein -
M7V54_RS05945 1238260..1239333 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
M7V54_RS05950 1239421..1239618 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M7V54_RS05955 1239615..1239989 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS05960 1240192..1240890 + 699 WP_003898733.1 hypothetical protein -
M7V54_RS05965 1241008..1241193 + 186 WP_003901093.1 hypothetical protein -
M7V54_RS05970 1241120..1241395 - 276 WP_003405867.1 hypothetical protein -
M7V54_RS05975 1241638..1241961 + 324 WP_003405871.1 putative quinol monooxygenase -
M7V54_RS05980 1241976..1242674 - 699 WP_031646953.1 hypothetical protein -
M7V54_RS05985 1242708..1242917 + 210 WP_003911400.1 hypothetical protein -
M7V54_RS05990 1242869..1243639 - 771 Protein_1180 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T263988 WP_003405865.1 NZ_CP110619:1239615-1239989 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT263988 WP_003405863.1 NZ_CP110619:1239421-1239618 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References