Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1230665..1231296 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WIH8 |
Locus tag | M7V54_RS05900 | Protein ID | WP_003898728.1 |
Coordinates | 1230665..1230976 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | M7V54_RS05905 | Protein ID | WP_003405836.1 |
Coordinates | 1230976..1231296 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11049.76 Da Isoelectric Point: 4.9371
>T263987 WP_003898728.1 NZ_CP110619:c1230976-1230665 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|