Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1230665..1231296 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WIH8 |
Locus tag | M7V54_RS05900 | Protein ID | WP_003898728.1 |
Coordinates | 1230665..1230976 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | M7V54_RS05905 | Protein ID | WP_003405836.1 |
Coordinates | 1230976..1231296 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS05880 | 1226146..1227570 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
M7V54_RS05885 | 1227601..1228689 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
M7V54_RS05890 | 1228745..1229389 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
M7V54_RS05895 | 1229396..1230553 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
M7V54_RS05900 | 1230665..1230976 | - | 312 | WP_003898728.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
M7V54_RS05905 | 1230976..1231296 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
M7V54_RS05910 | 1231306..1232842 | + | 1537 | Protein_1164 | carboxylesterase/lipase family protein | - |
M7V54_RS05915 | 1232849..1233961 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
M7V54_RS05920 | 1233971..1234228 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
M7V54_RS05925 | 1234218..1235465 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
M7V54_RS05930 | 1235462..1236100 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11049.76 Da Isoelectric Point: 4.9371
>T263987 WP_003898728.1 NZ_CP110619:c1230976-1230665 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|