Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1014685..1015304 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | M7V54_RS04825 | Protein ID | WP_003404726.1 |
Coordinates | 1014870..1015304 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | M7V54_RS04820 | Protein ID | WP_003898641.1 |
Coordinates | 1014685..1014864 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS04805 | 1010158..1011738 | + | 1581 | WP_003909313.1 | serine hydrolase | - |
M7V54_RS04810 | 1011735..1014128 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
M7V54_RS04815 | 1014401..1014559 | + | 159 | WP_003404720.1 | hypothetical protein | - |
M7V54_RS04820 | 1014685..1014864 | + | 180 | WP_003898641.1 | antitoxin | Antitoxin |
M7V54_RS04825 | 1014870..1015304 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
M7V54_RS04830 | 1015402..1016175 | + | 774 | WP_003404735.1 | VOC family protein | - |
M7V54_RS04835 | 1016240..1016689 | + | 450 | WP_003404738.1 | hypothetical protein | - |
M7V54_RS04840 | 1016824..1017054 | - | 231 | WP_003898642.1 | hypothetical protein | - |
M7V54_RS04845 | 1017221..1018729 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
M7V54_RS04850 | 1018731..1019969 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T263984 WP_003404726.1 NZ_CP110619:1014870-1015304 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|