Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-mazE/PIN(toxin) |
Location | 754983..755775 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | M7V54_RS03500 | Protein ID | WP_003403386.1 |
Coordinates | 755338..755775 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TQE0 |
Locus tag | M7V54_RS03495 | Protein ID | WP_003403381.1 |
Coordinates | 754983..755228 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS03465 | 750003..751508 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
M7V54_RS03470 | 751589..752599 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
M7V54_RS03475 | 752987..753370 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
M7V54_RS03480 | 753465..753620 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M7V54_RS03485 | 753696..754412 | - | 717 | WP_010886082.1 | CPBP family intramembrane metalloprotease | - |
M7V54_RS03490 | 754688..754996 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
M7V54_RS03495 | 754983..755228 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M7V54_RS03500 | 755338..755775 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS03505 | 755772..756026 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
M7V54_RS03510 | 756140..758503 | + | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
M7V54_RS03515 | 758566..758892 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M7V54_RS03520 | 758804..759142 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
M7V54_RS03525 | 759139..759312 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T263981 WP_003403386.1 NZ_CP110619:c755775-755338 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQE0 |