Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 752987..753620 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag M7V54_RS03475 Protein ID WP_003403365.1
Coordinates 752987..753370 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag M7V54_RS03480 Protein ID WP_003403368.1
Coordinates 753465..753620 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS03450 748279..748815 + 537 WP_003403341.1 50S ribosomal protein L10 -
M7V54_RS03455 748852..749244 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
M7V54_RS03460 749237..749932 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
M7V54_RS03465 750003..751508 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
M7V54_RS03470 751589..752599 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
M7V54_RS03475 752987..753370 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
M7V54_RS03480 753465..753620 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M7V54_RS03485 753696..754412 - 717 WP_010886082.1 CPBP family intramembrane metalloprotease -
M7V54_RS03490 754688..754996 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
M7V54_RS03495 754983..755228 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
M7V54_RS03500 755338..755775 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
M7V54_RS03505 755772..756026 - 255 WP_003911263.1 antitoxin VapB7 -
M7V54_RS03510 756140..758503 + 2364 WP_003898547.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T263979 WP_003403365.1 NZ_CP110619:c753370-752987 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT263979 WP_003403368.1 NZ_CP110619:c753620-753465 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References