Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 716413..717062 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | M7V54_RS03290 | Protein ID | WP_003403236.1 |
Coordinates | 716667..717062 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | M7V54_RS03285 | Protein ID | WP_003403235.1 |
Coordinates | 716413..716667 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS03260 | 711539..711622 | + | 84 | Protein_646 | galactose-1-phosphate uridylyltransferase | - |
M7V54_RS03265 | 711641..712722 | + | 1082 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
M7V54_RS03270 | 712719..713810 | + | 1092 | WP_003906403.1 | galactokinase | - |
M7V54_RS03275 | 714205..715269 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
M7V54_RS03280 | 715373..716320 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
M7V54_RS03285 | 716413..716667 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
M7V54_RS03290 | 716667..717062 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
M7V54_RS03295 | 717156..717896 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
M7V54_RS03300 | 718028..718288 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M7V54_RS03305 | 718285..718692 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
M7V54_RS03310 | 718764..719915 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
M7V54_RS03315 | 720008..721735 | - | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T263977 WP_003403236.1 NZ_CP110619:716667-717062 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC2 |