Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 710785..711410 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | M7V54_RS03255 | Protein ID | WP_003403218.1 |
Coordinates | 711009..711410 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | M7V54_RS03250 | Protein ID | WP_003403213.1 |
Coordinates | 710785..711012 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS03225 | 705964..706185 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
M7V54_RS03230 | 706327..706932 | + | 606 | WP_003898526.1 | hypothetical protein | - |
M7V54_RS03235 | 706951..709518 | - | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
M7V54_RS03240 | 709602..710351 | + | 750 | WP_003898528.1 | hypothetical protein | - |
M7V54_RS03245 | 710348..710590 | + | 243 | WP_003403210.1 | hypothetical protein | - |
M7V54_RS03250 | 710785..711012 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
M7V54_RS03255 | 711009..711410 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
M7V54_RS03260 | 711539..711622 | + | 84 | Protein_646 | galactose-1-phosphate uridylyltransferase | - |
M7V54_RS03265 | 711641..712722 | + | 1082 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
M7V54_RS03270 | 712719..713810 | + | 1092 | WP_003906403.1 | galactokinase | - |
M7V54_RS03275 | 714205..715269 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
M7V54_RS03280 | 715373..716320 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T263976 WP_003403218.1 NZ_CP110619:711009-711410 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |