Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 703247..703890 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | M7V54_RS03205 | Protein ID | WP_003403187.1 |
Coordinates | 703489..703890 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | M7V54_RS03200 | Protein ID | WP_003403184.1 |
Coordinates | 703247..703492 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS03165 | 698527..699057 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
M7V54_RS03170 | 699041..699736 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
M7V54_RS03175 | 699859..700170 | + | 312 | WP_003403164.1 | hypothetical protein | - |
M7V54_RS03180 | 700242..701192 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
M7V54_RS03185 | 701433..702017 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
M7V54_RS03190 | 702019..702729 | + | 711 | Protein_632 | IS607 family element RNA-guided endonuclease TnpB | - |
M7V54_RS03195 | 702732..703202 | + | 471 | WP_003898523.1 | hypothetical protein | - |
M7V54_RS03200 | 703247..703492 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M7V54_RS03205 | 703489..703890 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS03210 | 703881..704060 | + | 180 | Protein_636 | hypothetical protein | - |
M7V54_RS03215 | 704478..704675 | - | 198 | WP_003403191.1 | hypothetical protein | - |
M7V54_RS03220 | 704755..705912 | - | 1158 | WP_003898524.1 | hypothetical protein | - |
M7V54_RS03225 | 705964..706185 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
M7V54_RS03230 | 706327..706932 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T263975 WP_003403187.1 NZ_CP110619:703489-703890 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |