263974

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 697157..697803 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag M7V54_RS03150 Protein ID WP_003403137.1
Coordinates 697157..697570 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag M7V54_RS03155 Protein ID WP_003403139.1
Coordinates 697567..697803 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS03130 693240..694790 + 1551 WP_003403119.1 MlaD family protein -
M7V54_RS03135 694842..695234 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
M7V54_RS03140 695231..695488 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
M7V54_RS03145 695671..696906 - 1236 WP_003403128.1 ATP-binding protein -
M7V54_RS03150 697157..697570 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
M7V54_RS03155 697567..697803 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
M7V54_RS03160 697907..698413 - 507 WP_003900973.1 two component system sensor kinase HK1 -
M7V54_RS03165 698527..699057 - 531 WP_003917320.1 two component system sensor kinase HK2 -
M7V54_RS03170 699041..699736 - 696 WP_003918099.1 two-component system response regulator TcrA -
M7V54_RS03175 699859..700170 + 312 WP_003403164.1 hypothetical protein -
M7V54_RS03180 700242..701192 + 951 WP_003900184.1 DUF1259 domain-containing protein -
M7V54_RS03185 701433..702017 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
M7V54_RS03190 702019..702729 + 711 Protein_632 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T263974 WP_003403137.1 NZ_CP110619:c697570-697157 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT263974 WP_003403139.1 NZ_CP110619:c697803-697567 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References