Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
Location | 697157..697803 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ88 |
Locus tag | M7V54_RS03150 | Protein ID | WP_003403137.1 |
Coordinates | 697157..697570 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ89 |
Locus tag | M7V54_RS03155 | Protein ID | WP_003403139.1 |
Coordinates | 697567..697803 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS03130 | 693240..694790 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
M7V54_RS03135 | 694842..695234 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
M7V54_RS03140 | 695231..695488 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
M7V54_RS03145 | 695671..696906 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
M7V54_RS03150 | 697157..697570 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M7V54_RS03155 | 697567..697803 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | Antitoxin |
M7V54_RS03160 | 697907..698413 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
M7V54_RS03165 | 698527..699057 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
M7V54_RS03170 | 699041..699736 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
M7V54_RS03175 | 699859..700170 | + | 312 | WP_003403164.1 | hypothetical protein | - |
M7V54_RS03180 | 700242..701192 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
M7V54_RS03185 | 701433..702017 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
M7V54_RS03190 | 702019..702729 | + | 711 | Protein_632 | IS607 family element RNA-guided endonuclease TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T263974 WP_003403137.1 NZ_CP110619:c697570-697157 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|