Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
Location | 363252..363778 | Replicon | chromosome |
Accession | NZ_CP110619 | ||
Organism | Mycobacterium tuberculosis strain H37Rv-1 |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | M7V54_RS01585 | Protein ID | WP_003401560.1 |
Coordinates | 363476..363778 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | Rv0298 | Uniprot ID | P9WJ08 |
Locus tag | M7V54_RS01580 | Protein ID | WP_003401555.1 |
Coordinates | 363252..363479 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M7V54_RS01565 | 358945..359748 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
M7V54_RS01570 | 359758..361155 | - | 1398 | WP_003401544.1 | sulfatase | - |
M7V54_RS01575 | 361334..363109 | + | 1776 | WP_010886074.1 | PE family protein | - |
M7V54_RS01580 | 363252..363479 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M7V54_RS01585 | 363476..363778 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
M7V54_RS01590 | 363826..364047 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
M7V54_RS01595 | 364044..364469 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
M7V54_RS01600 | 364605..365237 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
M7V54_RS01605 | 365234..366142 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
M7V54_RS01610 | 366150..366740 | - | 591 | WP_229298012.1 | hypothetical protein | - |
M7V54_RS01615 | 366733..366783 | - | 51 | Protein_319 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T263967 WP_003401560.1 NZ_CP110619:363476-363778 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|