Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 71586..72219 | Replicon | chromosome |
| Accession | NZ_CP110619 | ||
| Organism | Mycobacterium tuberculosis strain H37Rv-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFC0 |
| Locus tag | M7V54_RS00360 | Protein ID | WP_003400580.1 |
| Coordinates | 71818..72219 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P0CW29 |
| Locus tag | M7V54_RS00355 | Protein ID | WP_003400577.1 |
| Coordinates | 71586..71825 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7V54_RS00340 | 66920..68359 | + | 1440 | WP_003901784.1 | FAD-binding oxidoreductase | - |
| M7V54_RS00345 | 68415..68576 | + | 162 | WP_003899796.1 | hypothetical protein | - |
| M7V54_RS00350 | 68617..71556 | + | 2940 | WP_009937016.1 | UPF0182 family protein | - |
| M7V54_RS00355 | 71586..71825 | + | 240 | WP_003400577.1 | antitoxin VapB1 | Antitoxin |
| M7V54_RS00360 | 71818..72219 | + | 402 | WP_003400580.1 | type II toxin-antitoxin system ribonuclease VapC1 | Toxin |
| M7V54_RS00365 | 72271..74508 | - | 2238 | WP_003899797.1 | NADP-dependent isocitrate dehydrogenase | - |
| M7V54_RS00370 | 74626..75195 | - | 570 | WP_003400591.1 | TetR/AcrR family transcriptional regulator | - |
| M7V54_RS00375 | 75298..76209 | + | 912 | WP_003912371.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.44 Da Isoelectric Point: 4.8887
>T263966 WP_003400580.1 NZ_CP110619:71818-72219 [Mycobacterium tuberculosis]
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BR82 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHM7 |