Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3594068..3594627 | Replicon | chromosome |
| Accession | NZ_CP110615 | ||
| Organism | Rhodococcus sp. 75 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | RHODO2019_RS17525 | Protein ID | WP_265382980.1 |
| Coordinates | 3594068..3594436 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | RHODO2019_RS17530 | Protein ID | WP_265382981.1 |
| Coordinates | 3594433..3594627 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RHODO2019_RS17505 (RHODO2019_17505) | 3590225..3591232 | - | 1008 | WP_265382976.1 | DUF2791 family P-loop domain-containing protein | - |
| RHODO2019_RS17510 (RHODO2019_17510) | 3591229..3592026 | - | 798 | WP_265382977.1 | hypothetical protein | - |
| RHODO2019_RS17515 (RHODO2019_17515) | 3592130..3593092 | - | 963 | WP_265382978.1 | ROK family protein | - |
| RHODO2019_RS17520 (RHODO2019_17520) | 3593537..3593806 | - | 270 | WP_265382979.1 | helix-turn-helix domain-containing protein | - |
| RHODO2019_RS17525 (RHODO2019_17525) | 3594068..3594436 | - | 369 | WP_265382980.1 | VapC toxin family PIN domain ribonuclease | Toxin |
| RHODO2019_RS17530 (RHODO2019_17530) | 3594433..3594627 | - | 195 | WP_265382981.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| RHODO2019_RS17535 (RHODO2019_17535) | 3594711..3597869 | - | 3159 | WP_265382982.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 12763.63 Da Isoelectric Point: 4.9949
>T263965 WP_265382980.1 NZ_CP110615:c3594436-3594068 [Rhodococcus sp. 75]
VSVLVDTSVWVDHLRTGNPRLAALLEQSRVLIHPWVLGELALGGVIRNAEVSTLLGALPRAPLVSDSELVGFIQTQALHG
RGVGYVDAQLLASTVLDPDAVLWSADKGLSAAAAELGVAHQT
VSVLVDTSVWVDHLRTGNPRLAALLEQSRVLIHPWVLGELALGGVIRNAEVSTLLGALPRAPLVSDSELVGFIQTQALHG
RGVGYVDAQLLASTVLDPDAVLWSADKGLSAAAAELGVAHQT
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|