Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-PHD |
| Location | 2827311..2827939 | Replicon | chromosome |
| Accession | NZ_CP110615 | ||
| Organism | Rhodococcus sp. 75 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | RHODO2019_RS13825 | Protein ID | WP_265382333.1 |
| Coordinates | 2827547..2827939 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | RHODO2019_RS13820 | Protein ID | WP_265382332.1 |
| Coordinates | 2827311..2827550 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RHODO2019_RS13795 (RHODO2019_13795) | 2822744..2823490 | + | 747 | WP_265382327.1 | SDR family oxidoreductase | - |
| RHODO2019_RS13800 (RHODO2019_13800) | 2823500..2824579 | - | 1080 | WP_265382328.1 | allantoicase | - |
| RHODO2019_RS13805 (RHODO2019_13805) | 2824576..2824983 | - | 408 | WP_265382329.1 | amidase | - |
| RHODO2019_RS13810 (RHODO2019_13810) | 2825113..2826135 | + | 1023 | WP_265382330.1 | LLM class flavin-dependent oxidoreductase | - |
| RHODO2019_RS13815 (RHODO2019_13815) | 2826138..2827232 | - | 1095 | WP_265382331.1 | CaiB/BaiF CoA-transferase family protein | - |
| RHODO2019_RS13820 (RHODO2019_13820) | 2827311..2827550 | + | 240 | WP_265382332.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| RHODO2019_RS13825 (RHODO2019_13825) | 2827547..2827939 | + | 393 | WP_265382333.1 | PIN domain-containing protein | Toxin |
| RHODO2019_RS13830 (RHODO2019_13830) | 2827952..2828683 | - | 732 | WP_265382334.1 | tyrosine-protein phosphatase | - |
| RHODO2019_RS13835 (RHODO2019_13835) | 2828683..2829012 | - | 330 | WP_265382335.1 | SDR family oxidoreductase | - |
| RHODO2019_RS13840 (RHODO2019_13840) | 2829062..2830045 | - | 984 | WP_265382336.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| RHODO2019_RS13845 (RHODO2019_13845) | 2830105..2831766 | - | 1662 | WP_265382337.1 | DUF885 domain-containing protein | - |
| RHODO2019_RS13850 (RHODO2019_13850) | 2831804..2831959 | + | 156 | WP_265382338.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14432.52 Da Isoelectric Point: 6.6066
>T263963 WP_265382333.1 NZ_CP110615:2827547-2827939 [Rhodococcus sp. 75]
VSAVVLDTHVLHWWSAEPERLSARAARAVEAADELVVAGITWYELAWLARHDRIRLAVPLTAWLDRLATEVRTVGITPAV
AVAATALPASFPGDPADRLIYATAVEHGWDLVTKDRRLHEHVHPRPVTVW
VSAVVLDTHVLHWWSAEPERLSARAARAVEAADELVVAGITWYELAWLARHDRIRLAVPLTAWLDRLATEVRTVGITPAV
AVAATALPASFPGDPADRLIYATAVEHGWDLVTKDRRLHEHVHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|