Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1991370..1991840 Replicon chromosome
Accession NZ_CP110611
Organism Staphylococcus epidermidis strain CCSM0287

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag OO001_RS09455 Protein ID WP_001829569.1
Coordinates 1991652..1991840 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag OO001_RS09450 Protein ID WP_002438963.1
Coordinates 1991370..1991627 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO001_RS09410 1986734..1987450 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
OO001_RS09415 1987611..1988033 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
OO001_RS09420 1988217..1988372 - 156 WP_001829648.1 hypothetical protein -
OO001_RS09425 1988384..1988571 - 188 Protein_1823 hypothetical protein -
OO001_RS09430 1988958..1989458 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
OO001_RS09435 1989729..1990316 - 588 WP_001829615.1 histidine phosphatase family protein -
OO001_RS09440 1990530..1990766 + 237 WP_002457224.1 hypothetical protein -
OO001_RS09445 1990758..1990961 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
OO001_RS09450 1991370..1991627 + 258 WP_002438963.1 hypothetical protein Antitoxin
OO001_RS09455 1991652..1991840 + 189 WP_001829569.1 hypothetical protein Toxin
OO001_RS09460 1992030..1992584 + 555 WP_058221961.1 lipoprotein N-acylation protein LnsA -
OO001_RS09465 1992644..1992877 - 234 WP_001829664.1 hypothetical protein -
OO001_RS09470 1993161..1993907 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
OO001_RS09475 1994006..1994290 + 285 WP_001829635.1 hypothetical protein -
OO001_RS09480 1994314..1994538 + 225 WP_001829613.1 hypothetical protein -
OO001_RS09485 1995159..1995359 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1988217..1988372 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T263962 WP_001829569.1 NZ_CP110611:1991652-1991840 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT263962 WP_002438963.1 NZ_CP110611:1991370-1991627 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References