Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/-
Location 4224844..4225234 Replicon chromosome
Accession NZ_CP110535
Organism Halomonas sp. BDJS001

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OM794_RS19625 Protein ID WP_226246771.1
Coordinates 4224844..4225062 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OM794_RS19630 Protein ID WP_226246770.1
Coordinates 4225049..4225234 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM794_RS19600 (OM794_19600) 4219985..4220911 + 927 WP_226246776.1 LysR family transcriptional regulator -
OM794_RS19605 (OM794_19605) 4221038..4222072 + 1035 WP_226246775.1 TRAP transporter substrate-binding protein DctP -
OM794_RS19610 (OM794_19610) 4222210..4222701 + 492 WP_226246774.1 TRAP transporter small permease -
OM794_RS19615 (OM794_19615) 4222721..4223995 + 1275 WP_226246773.1 TRAP transporter large permease -
OM794_RS19620 (OM794_19620) 4224016..4224780 + 765 WP_265153977.1 M15 family metallopeptidase -
OM794_RS19625 (OM794_19625) 4224844..4225062 - 219 WP_226246771.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OM794_RS19630 (OM794_19630) 4225049..4225234 - 186 WP_226246770.1 stability determinant Antitoxin
OM794_RS19635 (OM794_19635) 4225315..4226082 - 768 WP_226246769.1 amino acid ABC transporter ATP-binding protein -
OM794_RS19640 (OM794_19640) 4226075..4226740 - 666 WP_226246768.1 amino acid ABC transporter permease -
OM794_RS19645 (OM794_19645) 4226764..4227405 - 642 WP_226246767.1 amino acid ABC transporter permease -
OM794_RS19650 (OM794_19650) 4227488..4228345 - 858 WP_226246766.1 transporter substrate-binding domain-containing protein -
OM794_RS19655 (OM794_19655) 4228606..4229946 + 1341 WP_265153978.1 PLP-dependent aminotransferase family protein -
OM794_RS19660 (OM794_19660) 4229925..4230134 + 210 WP_265153979.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-59)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8307.50 Da        Isoelectric Point: 4.9313

>T263957 WP_226246771.1 NZ_CP110535:c4225062-4224844 [Halomonas sp. BDJS001]
MLLVEWRPQARESLWAILDYLSQRNPYAAEALYQAIEEATEALPQHPYLYRPGRVAGTREAVCTPTILWFTA

Download         Length: 219 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7052.81 Da        Isoelectric Point: 4.2257

>AT263957 WP_226246770.1 NZ_CP110535:c4225234-4225049 [Halomonas sp. BDJS001]
MSTPLDPIVSEFETQEQADSYQRWFCERVQASLDDPRPSIPHDDVMGEMRELIAKRRDAAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References