Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 291199..291785 Replicon chromosome
Accession NZ_CP110535
Organism Halomonas sp. BDJS001

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OM794_RS01510 Protein ID WP_138800211.1
Coordinates 291531..291785 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OM794_RS01505 Protein ID WP_226250277.1
Coordinates 291199..291534 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM794_RS01455 (OM794_01455) 286226..286600 - 375 WP_226250267.1 hypothetical protein -
OM794_RS01460 (OM794_01460) 286597..286851 - 255 WP_226250268.1 hypothetical protein -
OM794_RS01465 (OM794_01465) 286844..287203 - 360 WP_226250269.1 hypothetical protein -
OM794_RS01470 (OM794_01470) 287200..287727 - 528 WP_226250270.1 phage tail protein -
OM794_RS01475 (OM794_01475) 287724..288674 - 951 WP_226250271.1 phage tail protein I -
OM794_RS01480 (OM794_01480) 288671..289570 - 900 WP_226250272.1 baseplate J/gp47 family protein -
OM794_RS01485 (OM794_01485) 289567..289905 - 339 WP_226250273.1 GPW/gp25 family protein -
OM794_RS01490 (OM794_01490) 289908..290183 - 276 WP_226250274.1 PAAR domain-containing protein -
OM794_RS01495 (OM794_01495) 290193..290537 - 345 WP_226250275.1 hypothetical protein -
OM794_RS01500 (OM794_01500) 290564..290896 - 333 WP_265154204.1 phage baseplate assembly protein V -
OM794_RS01505 (OM794_01505) 291199..291534 - 336 WP_226250277.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OM794_RS01510 (OM794_01510) 291531..291785 - 255 WP_138800211.1 type II toxin-antitoxin system HicA family toxin Toxin
OM794_RS01515 (OM794_01515) 291831..292289 - 459 WP_226250278.1 phage virion morphogenesis protein -
OM794_RS01520 (OM794_01520) 292286..292780 - 495 WP_226250279.1 phage tail protein -
OM794_RS01525 (OM794_01525) 292892..293314 - 423 WP_226250280.1 Rz-like lysis system protein LysB -
OM794_RS01530 (OM794_01530) 293311..293796 - 486 WP_226250281.1 lysozyme -
OM794_RS01535 (OM794_01535) 293786..293992 - 207 WP_226250282.1 hypothetical protein -
OM794_RS01540 (OM794_01540) 294000..294215 - 216 WP_226250283.1 tail protein X -
OM794_RS01545 (OM794_01545) 294212..294679 - 468 WP_226250284.1 head completion/stabilization protein -
OM794_RS01550 (OM794_01550) 294780..295460 - 681 WP_226250285.1 phage terminase small subunit -
OM794_RS01555 (OM794_01555) 295470..296519 - 1050 WP_226250286.1 phage major capsid protein, P2 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 261242..306002 44760


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-75)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9413.75 Da        Isoelectric Point: 8.8075

>T263952 WP_138800211.1 NZ_CP110535:c291785-291531 [Halomonas sp. BDJS001]
MKRKHAKTLAAIFSRPTPGTIAWSDIESLFKAMGAEIQEREGSRIAVVLFDEVRVFHRPHPSPDTDKGAVASIRKWLEEN
GETP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12408.08 Da        Isoelectric Point: 5.1702

>AT263952 WP_226250277.1 NZ_CP110535:c291534-291199 [Halomonas sp. BDJS001]
MNNIMIIDGYRAVIQYDPDIEMFRGEFIGLSGGADFYADSVAKLRDEGEISLRIFLEECQKRGIKPTKTYSGKFQVRLPE
DLHKHAADAATAKGQSLNQFVATAIEHELSV

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References