Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4599934..4600550 | Replicon | chromosome |
| Accession | NZ_CP110534 | ||
| Organism | Enterobacter roggenkampii strain WS28-4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OM420_RS21705 | Protein ID | WP_084832108.1 |
| Coordinates | 4599934..4600305 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | OM420_RS21710 | Protein ID | WP_015569912.1 |
| Coordinates | 4600308..4600550 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM420_RS21690 (OM420_21680) | 4597434..4598336 | + | 903 | WP_008501831.1 | formate dehydrogenase subunit beta | - |
| OM420_RS21695 (OM420_21685) | 4598333..4598968 | + | 636 | WP_008501832.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OM420_RS21700 (OM420_21690) | 4598965..4599894 | + | 930 | WP_025912306.1 | formate dehydrogenase accessory protein FdhE | - |
| OM420_RS21705 (OM420_21695) | 4599934..4600305 | - | 372 | WP_084832108.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM420_RS21710 (OM420_21700) | 4600308..4600550 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OM420_RS21715 (OM420_21705) | 4600749..4601669 | + | 921 | WP_094945022.1 | alpha/beta hydrolase | - |
| OM420_RS21720 (OM420_21710) | 4601678..4602619 | - | 942 | WP_023326334.1 | fatty acid biosynthesis protein FabY | - |
| OM420_RS21725 (OM420_21715) | 4602664..4603101 | - | 438 | WP_008501836.1 | D-aminoacyl-tRNA deacylase | - |
| OM420_RS21730 (OM420_21720) | 4603098..4603979 | - | 882 | WP_021242790.1 | virulence factor BrkB family protein | - |
| OM420_RS21735 (OM420_21725) | 4603973..4604572 | - | 600 | WP_008501839.1 | glucose-1-phosphatase | - |
| OM420_RS21740 (OM420_21730) | 4604661..4605164 | - | 504 | WP_225828756.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13686.79 Da Isoelectric Point: 6.3290
>T263951 WP_084832108.1 NZ_CP110534:c4600305-4599934 [Enterobacter roggenkampii]
MEHMAVFDTNILIDLFNNRVEAADAIENTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLVSRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIENTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLVSRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|