Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3857533..3858190 | Replicon | chromosome |
Accession | NZ_CP110534 | ||
Organism | Enterobacter roggenkampii strain WS28-4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
Locus tag | OM420_RS18145 | Protein ID | WP_021242050.1 |
Coordinates | 3857533..3857943 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W7NX65 |
Locus tag | OM420_RS18150 | Protein ID | WP_006178375.1 |
Coordinates | 3857924..3858190 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM420_RS18125 (OM420_18120) | 3853526..3855259 | - | 1734 | WP_094944166.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OM420_RS18130 (OM420_18125) | 3855265..3855978 | - | 714 | WP_021242049.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OM420_RS18135 (OM420_18130) | 3856007..3856903 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
OM420_RS18140 (OM420_18135) | 3857005..3857526 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
OM420_RS18145 (OM420_18140) | 3857533..3857943 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
OM420_RS18150 (OM420_18145) | 3857924..3858190 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
OM420_RS18155 (OM420_18150) | 3858485..3859465 | + | 981 | WP_047745992.1 | tRNA-modifying protein YgfZ | - |
OM420_RS18160 (OM420_18155) | 3859550..3860209 | - | 660 | WP_021242052.1 | hemolysin III family protein | - |
OM420_RS18165 (OM420_18160) | 3860475..3861206 | + | 732 | WP_094944346.1 | MurR/RpiR family transcriptional regulator | - |
OM420_RS18170 (OM420_18165) | 3861323..3862756 | + | 1434 | WP_023294510.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T263950 WP_021242050.1 NZ_CP110534:c3857943-3857533 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7NX65 |