Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1054979..1055599 | Replicon | chromosome |
Accession | NZ_CP110534 | ||
Organism | Enterobacter roggenkampii strain WS28-4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | OM420_RS04910 | Protein ID | WP_008499287.1 |
Coordinates | 1054979..1055197 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | OM420_RS04915 | Protein ID | WP_008499288.1 |
Coordinates | 1055225..1055599 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM420_RS04880 (OM420_04880) | 1050992..1051252 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
OM420_RS04885 (OM420_04885) | 1051255..1051395 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OM420_RS04890 (OM420_04890) | 1051392..1052102 | - | 711 | WP_021241637.1 | GNAT family protein | - |
OM420_RS04895 (OM420_04895) | 1052204..1053664 | + | 1461 | WP_008499284.1 | PLP-dependent aminotransferase family protein | - |
OM420_RS04900 (OM420_04900) | 1053636..1054103 | - | 468 | WP_059362219.1 | YlaC family protein | - |
OM420_RS04905 (OM420_04905) | 1054221..1054772 | - | 552 | WP_045416680.1 | maltose O-acetyltransferase | - |
OM420_RS04910 (OM420_04910) | 1054979..1055197 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
OM420_RS04915 (OM420_04915) | 1055225..1055599 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
OM420_RS04920 (OM420_04920) | 1056109..1059255 | - | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OM420_RS04925 (OM420_04925) | 1059278..1060471 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T263943 WP_008499287.1 NZ_CP110534:c1055197-1054979 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT263943 WP_008499288.1 NZ_CP110534:c1055599-1055225 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |