Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 927423..928176 | Replicon | chromosome |
Accession | NZ_CP110534 | ||
Organism | Enterobacter roggenkampii strain WS28-4 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | OM420_RS04305 | Protein ID | WP_071988264.1 |
Coordinates | 927808..928176 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OM420_RS04300 | Protein ID | WP_094945068.1 |
Coordinates | 927423..927773 (+) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM420_RS04270 (OM420_04270) | 922600..923751 | - | 1152 | WP_127341237.1 | hypothetical protein | - |
OM420_RS04275 (OM420_04275) | 923849..924742 | + | 894 | WP_004129354.1 | 50S ribosome-binding GTPase | - |
OM420_RS04280 (OM420_04280) | 925027..925704 | + | 678 | WP_004129352.1 | hypothetical protein | - |
OM420_RS04285 (OM420_04285) | 925800..926621 | + | 822 | WP_165771489.1 | DUF932 domain-containing protein | - |
OM420_RS04290 (OM420_04290) | 926692..927165 | + | 474 | WP_004129349.1 | DNA repair protein RadC | - |
OM420_RS04295 (OM420_04295) | 927181..927402 | + | 222 | WP_004129348.1 | DUF987 domain-containing protein | - |
OM420_RS04300 (OM420_04300) | 927423..927773 | + | 351 | WP_094945068.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OM420_RS04305 (OM420_04305) | 927808..928176 | + | 369 | WP_071988264.1 | TA system toxin CbtA family protein | Toxin |
OM420_RS04310 (OM420_04310) | 928748..929812 | + | 1065 | WP_094945069.1 | hypothetical protein | - |
OM420_RS04315 (OM420_04315) | 929809..930108 | + | 300 | WP_025912594.1 | hypothetical protein | - |
OM420_RS04320 (OM420_04320) | 930422..931099 | - | 678 | WP_094945070.1 | type A chloramphenicol O-acetyltransferase | - |
OM420_RS04325 (OM420_04325) | 931163..933094 | - | 1932 | WP_094945071.1 | GGDEF domain-containing phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 902206..933606 | 31400 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13824.97 Da Isoelectric Point: 8.2789
>T263942 WP_071988264.1 NZ_CP110534:927808-928176 [Enterobacter roggenkampii]
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLVEKYELIRIDRRGF
SSQGQVPYLTVTDILHARRACGLTNSCPYREVSNIVLSRSRQ
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLVEKYELIRIDRRGF
SSQGQVPYLTVTDILHARRACGLTNSCPYREVSNIVLSRSRQ
Download Length: 369 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 13014.78 Da Isoelectric Point: 6.9559
>AT263942 WP_094945068.1 NZ_CP110534:927423-927773 [Enterobacter roggenkampii]
MSSKTLTVNDDTAEPWWGLNRNVIPCFGARLVQEGNRLHYLSDRASITGQFNKADLLHLDQAFPVLLKQAELMLTSSELN
PRHQHSVTLYAKGLTCEVDTLGSCGHVYISIYPTQR
MSSKTLTVNDDTAEPWWGLNRNVIPCFGARLVQEGNRLHYLSDRASITGQFNKADLLHLDQAFPVLLKQAELMLTSSELN
PRHQHSVTLYAKGLTCEVDTLGSCGHVYISIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|