Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
| Location | 4637282..4637898 | Replicon | chromosome |
| Accession | NZ_CP110533 | ||
| Organism | Enterobacter quasiroggenkampii strain WS12-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OM418_RS21935 | Protein ID | WP_277718195.1 |
| Coordinates | 4637282..4637653 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1H8XBY4 |
| Locus tag | OM418_RS21940 | Protein ID | WP_045909092.1 |
| Coordinates | 4637656..4637898 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM418_RS21920 (OM418_21920) | 4634782..4635684 | + | 903 | WP_277718193.1 | formate dehydrogenase subunit beta | - |
| OM418_RS21925 (OM418_21925) | 4635681..4636316 | + | 636 | WP_008501832.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OM418_RS21930 (OM418_21930) | 4636313..4637242 | + | 930 | WP_277718194.1 | formate dehydrogenase accessory protein FdhE | - |
| OM418_RS21935 (OM418_21935) | 4637282..4637653 | - | 372 | WP_277718195.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM418_RS21940 (OM418_21940) | 4637656..4637898 | - | 243 | WP_045909092.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| OM418_RS21945 (OM418_21945) | 4638097..4639017 | + | 921 | WP_252074188.1 | alpha/beta hydrolase | - |
| OM418_RS21950 (OM418_21950) | 4639026..4639967 | - | 942 | WP_023309755.1 | fatty acid biosynthesis protein FabY | - |
| OM418_RS21955 (OM418_21955) | 4640012..4640449 | - | 438 | WP_008501836.1 | D-aminoacyl-tRNA deacylase | - |
| OM418_RS21960 (OM418_21960) | 4640446..4641327 | - | 882 | WP_277718196.1 | virulence factor BrkB family protein | - |
| OM418_RS21965 (OM418_21965) | 4641321..4641920 | - | 600 | WP_045909089.1 | glucose-1-phosphatase | - |
| OM418_RS21970 (OM418_21970) | 4642326..4642805 | + | 480 | WP_277718197.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13656.80 Da Isoelectric Point: 6.9790
>T263939 WP_277718195.1 NZ_CP110533:c4637653-4637282 [Enterobacter quasiroggenkampii]
MEHMAVFDTNILIDLFNNRVEAANTIENTASHRSISLITWMEVMVGARKHGHEAKTAAVMGAFEVIDVTREIAERSVVLR
EKHGMKLPDAIILATAQSRNCPLVTRNTKDFQGIAGVVLPYQL
MEHMAVFDTNILIDLFNNRVEAANTIENTASHRSISLITWMEVMVGARKHGHEAKTAAVMGAFEVIDVTREIAERSVVLR
EKHGMKLPDAIILATAQSRNCPLVTRNTKDFQGIAGVVLPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|