Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3862094..3862751 | Replicon | chromosome |
Accession | NZ_CP110533 | ||
Organism | Enterobacter quasiroggenkampii strain WS12-3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
Locus tag | OM418_RS18185 | Protein ID | WP_021242050.1 |
Coordinates | 3862094..3862504 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W7NX65 |
Locus tag | OM418_RS18190 | Protein ID | WP_006178375.1 |
Coordinates | 3862485..3862751 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM418_RS18165 (OM418_18170) | 3858087..3859820 | - | 1734 | WP_277718051.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OM418_RS18170 (OM418_18175) | 3859826..3860539 | - | 714 | WP_023333302.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OM418_RS18175 (OM418_18180) | 3860568..3861464 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
OM418_RS18180 (OM418_18185) | 3861566..3862087 | + | 522 | WP_277718052.1 | flavodoxin FldB | - |
OM418_RS18185 (OM418_18190) | 3862094..3862504 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
OM418_RS18190 (OM418_18195) | 3862485..3862751 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
OM418_RS18195 (OM418_18200) | 3863046..3864026 | + | 981 | WP_045909913.1 | tRNA-modifying protein YgfZ | - |
OM418_RS18200 (OM418_18205) | 3864111..3864770 | - | 660 | WP_045335239.1 | hemolysin III family protein | - |
OM418_RS18205 (OM418_18210) | 3865036..3865767 | + | 732 | WP_208763929.1 | MurR/RpiR family transcriptional regulator | - |
OM418_RS18210 (OM418_18215) | 3865884..3867317 | + | 1434 | WP_048224765.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T263938 WP_021242050.1 NZ_CP110533:c3862504-3862094 [Enterobacter quasiroggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7NX65 |