Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1076174..1076794 | Replicon | chromosome |
| Accession | NZ_CP110533 | ||
| Organism | Enterobacter quasiroggenkampii strain WS12-3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | OM418_RS04980 | Protein ID | WP_008499287.1 |
| Coordinates | 1076174..1076392 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | OM418_RS04985 | Protein ID | WP_008499288.1 |
| Coordinates | 1076420..1076794 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM418_RS04950 (OM418_04950) | 1072185..1072445 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
| OM418_RS04955 (OM418_04955) | 1072448..1072588 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OM418_RS04960 (OM418_04960) | 1072585..1073295 | - | 711 | WP_111967303.1 | GNAT family protein | - |
| OM418_RS04965 (OM418_04965) | 1073397..1074857 | + | 1461 | WP_111967304.1 | PLP-dependent aminotransferase family protein | - |
| OM418_RS04970 (OM418_04970) | 1074829..1075296 | - | 468 | WP_045909756.1 | YlaC family protein | - |
| OM418_RS04975 (OM418_04975) | 1075414..1075965 | - | 552 | WP_045909755.1 | maltose O-acetyltransferase | - |
| OM418_RS04980 (OM418_04980) | 1076174..1076392 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| OM418_RS04985 (OM418_04985) | 1076420..1076794 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| OM418_RS04990 (OM418_04990) | 1077303..1080449 | - | 3147 | WP_045909754.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OM418_RS04995 (OM418_04995) | 1080472..1081665 | - | 1194 | WP_045909753.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T263931 WP_008499287.1 NZ_CP110533:c1076392-1076174 [Enterobacter quasiroggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT263931 WP_008499288.1 NZ_CP110533:c1076794-1076420 [Enterobacter quasiroggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |