Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 261420..262016 | Replicon | chromosome |
| Accession | NZ_CP110533 | ||
| Organism | Enterobacter quasiroggenkampii strain WS12-3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OM418_RS01175 | Protein ID | WP_214598992.1 |
| Coordinates | 261714..262016 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | W7P674 |
| Locus tag | OM418_RS01170 | Protein ID | WP_021242718.1 |
| Coordinates | 261420..261707 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM418_RS01165 (OM418_01165) | 259792..261423 | + | 1632 | WP_277718270.1 | Na/Pi cotransporter family protein | - |
| OM418_RS01170 (OM418_01170) | 261420..261707 | - | 288 | WP_021242718.1 | putative addiction module antidote protein | Antitoxin |
| OM418_RS01175 (OM418_01175) | 261714..262016 | - | 303 | WP_214598992.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM418_RS01180 (OM418_01180) | 262214..263086 | + | 873 | WP_008503414.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| OM418_RS01185 (OM418_01185) | 263087..263359 | - | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
| OM418_RS01190 (OM418_01190) | 263410..264354 | - | 945 | WP_045909140.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| OM418_RS01195 (OM418_01195) | 264460..266034 | - | 1575 | WP_277718271.1 | RNA repair transcriptional activator RtcR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11399.20 Da Isoelectric Point: 10.0577
>T263930 WP_214598992.1 NZ_CP110533:c262016-261714 [Enterobacter quasiroggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|