Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3834022..3834679 | Replicon | chromosome |
| Accession | NZ_CP110532 | ||
| Organism | Enterobacter roggenkampii strain ws6-3 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W7P4L3 |
| Locus tag | OM095_RS18330 | Protein ID | WP_023326024.1 |
| Coordinates | 3834022..3834432 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | OM095_RS18335 | Protein ID | WP_006178375.1 |
| Coordinates | 3834413..3834679 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM095_RS18310 (OM095_18300) | 3830015..3831748 | - | 1734 | WP_095428707.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OM095_RS18315 (OM095_18305) | 3831754..3832467 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OM095_RS18320 (OM095_18310) | 3832496..3833392 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
| OM095_RS18325 (OM095_18315) | 3833494..3834015 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
| OM095_RS18330 (OM095_18320) | 3834022..3834432 | - | 411 | WP_023326024.1 | protein YgfX | Toxin |
| OM095_RS18335 (OM095_18325) | 3834413..3834679 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| OM095_RS18340 (OM095_18330) | 3834974..3835954 | + | 981 | WP_045335240.1 | tRNA-modifying protein YgfZ | - |
| OM095_RS18345 (OM095_18335) | 3836039..3836698 | - | 660 | WP_021242052.1 | hemolysin III family protein | - |
| OM095_RS18350 (OM095_18340) | 3836964..3837695 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
| OM095_RS18355 (OM095_18345) | 3837812..3839245 | + | 1434 | WP_095428708.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16063.06 Da Isoelectric Point: 10.9468
>T263928 WP_023326024.1 NZ_CP110532:c3834432-3834022 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|