Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1058265..1058885 | Replicon | chromosome |
Accession | NZ_CP110532 | ||
Organism | Enterobacter roggenkampii strain ws6-3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | OM095_RS04950 | Protein ID | WP_008499287.1 |
Coordinates | 1058265..1058483 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | OM095_RS04955 | Protein ID | WP_008499288.1 |
Coordinates | 1058511..1058885 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM095_RS04920 (OM095_04920) | 1054278..1054538 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
OM095_RS04925 (OM095_04925) | 1054541..1054681 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OM095_RS04930 (OM095_04930) | 1054678..1055388 | - | 711 | WP_065101748.1 | GNAT family protein | - |
OM095_RS04935 (OM095_04935) | 1055490..1056950 | + | 1461 | WP_277715273.1 | PLP-dependent aminotransferase family protein | - |
OM095_RS04940 (OM095_04940) | 1056922..1057389 | - | 468 | WP_008499285.1 | YlaC family protein | - |
OM095_RS04945 (OM095_04945) | 1057507..1058058 | - | 552 | WP_008499286.1 | maltose O-acetyltransferase | - |
OM095_RS04950 (OM095_04950) | 1058265..1058483 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
OM095_RS04955 (OM095_04955) | 1058511..1058885 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
OM095_RS04960 (OM095_04960) | 1059395..1062541 | - | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OM095_RS04965 (OM095_04965) | 1062564..1063757 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T263922 WP_008499287.1 NZ_CP110532:c1058483-1058265 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT263922 WP_008499288.1 NZ_CP110532:c1058885-1058511 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |