Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 143873..144480 | Replicon | chromosome |
Accession | NZ_CP110532 | ||
Organism | Enterobacter roggenkampii strain ws6-3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7H0N5B9 |
Locus tag | OM095_RS00650 | Protein ID | WP_071993467.1 |
Coordinates | 143873..144058 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A155E9Y3 |
Locus tag | OM095_RS00655 | Protein ID | WP_032675741.1 |
Coordinates | 144073..144480 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM095_RS00635 (OM095_00635) | 140287..141825 | + | 1539 | WP_023345218.1 | aldehyde dehydrogenase AldB | - |
OM095_RS00640 (OM095_00640) | 141822..142784 | - | 963 | WP_008502735.1 | LysR family transcriptional regulator | - |
OM095_RS00645 (OM095_00645) | 142905..143663 | + | 759 | WP_095428897.1 | MipA/OmpV family protein | - |
OM095_RS00650 (OM095_00650) | 143873..144058 | + | 186 | WP_071993467.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OM095_RS00655 (OM095_00655) | 144073..144480 | + | 408 | WP_032675741.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OM095_RS00660 (OM095_00660) | 144484..145560 | - | 1077 | WP_032654523.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
OM095_RS00665 (OM095_00665) | 145906..146601 | - | 696 | WP_095428898.1 | L-ribulose-5-phosphate 4-epimerase | - |
OM095_RS00670 (OM095_00670) | 146595..147455 | - | 861 | WP_021242445.1 | L-ribulose-5-phosphate 3-epimerase | - |
OM095_RS00675 (OM095_00675) | 147458..148111 | - | 654 | WP_032654530.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6882.06 Da Isoelectric Point: 11.2341
>T263920 WP_071993467.1 NZ_CP110532:143873-144058 [Enterobacter roggenkampii]
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15010.78 Da Isoelectric Point: 4.3897
>AT263920 WP_032675741.1 NZ_CP110532:144073-144480 [Enterobacter roggenkampii]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDNALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDNALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H0N5B9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A155E9Y3 |