Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 45689..46350 | Replicon | chromosome |
| Accession | NZ_CP110532 | ||
| Organism | Enterobacter roggenkampii strain ws6-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OM095_RS00230 | Protein ID | WP_023293716.1 |
| Coordinates | 45952..46350 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A156KC23 |
| Locus tag | OM095_RS00225 | Protein ID | WP_032675702.1 |
| Coordinates | 45689..45955 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM095_RS00200 (OM095_00200) | 41742..43070 | - | 1329 | WP_023326395.1 | PTS sugar transporter subunit IIC | - |
| OM095_RS00205 (OM095_00205) | 43082..43396 | - | 315 | WP_008500132.1 | PTS sugar transporter subunit IIB | - |
| OM095_RS00210 (OM095_00210) | 43690..44640 | + | 951 | WP_023293714.1 | LacI family DNA-binding transcriptional regulator | - |
| OM095_RS00215 (OM095_00215) | 44702..44998 | - | 297 | WP_059365122.1 | YicS family protein | - |
| OM095_RS00220 (OM095_00220) | 45140..45559 | + | 420 | WP_008500129.1 | GNAT family N-acetyltransferase | - |
| OM095_RS00225 (OM095_00225) | 45689..45955 | + | 267 | WP_032675702.1 | virulence protein | Antitoxin |
| OM095_RS00230 (OM095_00230) | 45952..46350 | + | 399 | WP_023293716.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM095_RS00235 (OM095_00235) | 46490..47290 | + | 801 | WP_008500128.1 | lipoprotein NlpA | - |
| OM095_RS00240 (OM095_00240) | 47413..48192 | + | 780 | WP_095428878.1 | MBL fold metallo-hydrolase | - |
| OM095_RS00245 (OM095_00245) | 48219..49172 | + | 954 | WP_044597401.1 | helix-turn-helix domain-containing protein | - |
| OM095_RS00250 (OM095_00250) | 49355..51052 | + | 1698 | WP_277715335.1 | ShlB/FhaC/HecB family hemolysin secretion/activation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14799.00 Da Isoelectric Point: 6.4779
>T263919 WP_023293716.1 NZ_CP110532:45952-46350 [Enterobacter roggenkampii]
MRHMLDTNIVSHLFKRHPEVVSRMTCLAPGDVCISSITEAELLYGADKKKSSRLKETIREFLNTITICDWDSDAAATYGE
LRATLEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFRMVQELAVEDWTTTL
MRHMLDTNIVSHLFKRHPEVVSRMTCLAPGDVCISSITEAELLYGADKKKSSRLKETIREFLNTITICDWDSDAAATYGE
LRATLEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFRMVQELAVEDWTTTL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|