Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 19989..20632 | Replicon | plasmid pRWS292.s3 |
| Accession | NZ_CP110526 | ||
| Organism | Klebsiella pneumoniae strain WS_29-2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OM422_RS28680 | Protein ID | WP_001044770.1 |
| Coordinates | 20216..20632 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OM422_RS28675 | Protein ID | WP_001261282.1 |
| Coordinates | 19989..20219 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM422_RS28655 (OM422_28635) | 16054..17427 | + | 1374 | WP_004206605.1 | hypothetical protein | - |
| OM422_RS28660 (OM422_28640) | 17612..18940 | + | 1329 | WP_004206607.1 | nucleotidyltransferase | - |
| OM422_RS28665 (OM422_28645) | 18948..19523 | + | 576 | WP_004206608.1 | SLATT domain-containing protein | - |
| OM422_RS28670 (OM422_28650) | 19790..20032 | - | 243 | Protein_17 | hypothetical protein | - |
| OM422_RS28675 (OM422_28655) | 19989..20219 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OM422_RS28680 (OM422_28660) | 20216..20632 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM422_RS28685 (OM422_28665) | 20706..22268 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OM422_RS28690 (OM422_28670) | 22253..23275 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OM422_RS28695 (OM422_28675) | 23819..24727 | + | 909 | WP_032426221.1 | HNH endonuclease | - |
| OM422_RS28700 (OM422_28680) | 24913..25263 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..213187 | 213187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T263915 WP_001044770.1 NZ_CP110526:20216-20632 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |