Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 207738..208489 | Replicon | plasmid pRWS292.s1 |
Accession | NZ_CP110524 | ||
Organism | Klebsiella pneumoniae strain WS_29-2 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | OM422_RS26495 | Protein ID | WP_016946197.1 |
Coordinates | 207738..208220 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | OM422_RS26500 | Protein ID | WP_004902250.1 |
Coordinates | 208211..208489 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM422_RS26475 (OM422_26460) | 203281..203607 | - | 327 | Protein_226 | IS1 family transposase | - |
OM422_RS26480 (OM422_26465) | 203641..204246 | - | 606 | WP_000509966.1 | recombinase family protein | - |
OM422_RS26485 (OM422_26470) | 204341..207238 | + | 2898 | WP_001553819.1 | Tn3-like element Tn5403 family transposase | - |
OM422_RS26490 (OM422_26475) | 207274..207647 | - | 374 | Protein_229 | IS1 family transposase | - |
OM422_RS26495 (OM422_26480) | 207738..208220 | - | 483 | WP_016946197.1 | GNAT family N-acetyltransferase | Toxin |
OM422_RS26500 (OM422_26485) | 208211..208489 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
OM422_RS26505 (OM422_26490) | 208611..208823 | - | 213 | WP_016946198.1 | hypothetical protein | - |
OM422_RS26510 (OM422_26495) | 208931..209272 | - | 342 | WP_032437747.1 | hypothetical protein | - |
OM422_RS26515 (OM422_26500) | 210179..210493 | + | 315 | WP_065800137.1 | hypothetical protein | - |
OM422_RS26520 (OM422_26505) | 210737..211219 | - | 483 | WP_169510637.1 | hypothetical protein | - |
OM422_RS26525 (OM422_26510) | 212447..213331 | + | 885 | WP_004186900.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..361091 | 361091 | |
- | inside | IScluster/Tn | - | - | 187012..207647 | 20635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17724.53 Da Isoelectric Point: 8.9130
>T263912 WP_016946197.1 NZ_CP110524:c208220-207738 [Klebsiella pneumoniae]
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|