Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 189809..190331 | Replicon | plasmid pRWS292.s1 |
Accession | NZ_CP110524 | ||
Organism | Klebsiella pneumoniae strain WS_29-2 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A9J6S4Z8 |
Locus tag | OM422_RS26400 | Protein ID | WP_004187019.1 |
Coordinates | 190047..190331 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
Locus tag | OM422_RS26395 | Protein ID | WP_004187025.1 |
Coordinates | 189809..190057 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM422_RS26375 (OM422_26360) | 184832..185806 | + | 975 | WP_003032095.1 | SIS domain-containing protein | - |
OM422_RS26380 (OM422_26365) | 185819..186631 | + | 813 | WP_040120122.1 | PfkB family carbohydrate kinase | - |
OM422_RS26385 (OM422_26370) | 187012..188037 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
OM422_RS26390 (OM422_26375) | 188332..189300 | + | 969 | WP_000654811.1 | IS5 family transposase | - |
OM422_RS26395 (OM422_26380) | 189809..190057 | + | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
OM422_RS26400 (OM422_26385) | 190047..190331 | + | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM422_RS26405 (OM422_26390) | 190347..191645 | - | 1299 | WP_277696568.1 | ISNCY family transposase | - |
OM422_RS26410 (OM422_26395) | 191679..192647 | - | 969 | WP_000654811.1 | IS5 family transposase | - |
OM422_RS26415 (OM422_26400) | 192844..194376 | + | 1533 | WP_009310015.1 | IS3-like element ISKpn38 family transposase | - |
OM422_RS26420 (OM422_26405) | 194643..195071 | - | 429 | WP_277696550.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..361091 | 361091 | |
- | inside | IScluster/Tn | - | - | 187012..207647 | 20635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11003.72 Da Isoelectric Point: 10.5388
>T263911 WP_004187019.1 NZ_CP110524:190047-190331 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|