Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 43923..44449 | Replicon | plasmid pRWS292.s1 |
| Accession | NZ_CP110524 | ||
| Organism | Klebsiella pneumoniae strain WS_29-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OM422_RS25625 | Protein ID | WP_000323025.1 |
| Coordinates | 44162..44449 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OM422_RS25620 | Protein ID | WP_000534858.1 |
| Coordinates | 43923..44162 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM422_RS25600 (OM422_25585) | 39982..41322 | + | 1341 | WP_000589001.1 | ISNCY family transposase | - |
| OM422_RS25605 (OM422_25590) | 41965..42537 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| OM422_RS25610 (OM422_25595) | 42737..43660 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| OM422_RS25615 (OM422_25600) | 43794..43898 | - | 105 | Protein_54 | protein YdfV | - |
| OM422_RS25620 (OM422_25605) | 43923..44162 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OM422_RS25625 (OM422_25610) | 44162..44449 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OM422_RS25630 (OM422_25615) | 44521..44679 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| OM422_RS25635 (OM422_25620) | 45282..46256 | + | 975 | WP_004181899.1 | hypothetical protein | - |
| OM422_RS25640 (OM422_25625) | 46454..46831 | - | 378 | WP_004181901.1 | hypothetical protein | - |
| OM422_RS25645 (OM422_25630) | 47521..48588 | + | 1068 | WP_004181903.1 | hypothetical protein | - |
| OM422_RS25650 (OM422_25635) | 48744..49091 | + | 348 | WP_004181904.1 | hypothetical protein | - |
| OM422_RS25655 (OM422_25640) | 49170..49403 | + | 234 | WP_004181905.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..361091 | 361091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T263907 WP_000323025.1 NZ_CP110524:44162-44449 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|