Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4593782..4594298 | Replicon | chromosome |
Accession | NZ_CP110523 | ||
Organism | Klebsiella pneumoniae strain WS_29-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OM422_RS22505 | Protein ID | WP_004178374.1 |
Coordinates | 4593782..4594066 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OM422_RS22510 | Protein ID | WP_002886901.1 |
Coordinates | 4594056..4594298 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM422_RS22480 (4589198) | 4589198..4589461 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
OM422_RS22485 (4589591) | 4589591..4589764 | + | 174 | WP_002886906.1 | hypothetical protein | - |
OM422_RS22490 (4589767) | 4589767..4590510 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OM422_RS22495 (4590867) | 4590867..4593005 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OM422_RS22500 (4593314) | 4593314..4593778 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OM422_RS22505 (4593782) | 4593782..4594066 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM422_RS22510 (4594056) | 4594056..4594298 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OM422_RS22515 (4594376) | 4594376..4596286 | - | 1911 | WP_032421964.1 | PRD domain-containing protein | - |
OM422_RS22520 (4596309) | 4596309..4597463 | - | 1155 | WP_032421963.1 | lactonase family protein | - |
OM422_RS22525 (4597530) | 4597530..4598270 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T263903 WP_004178374.1 NZ_CP110523:c4594066-4593782 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |