Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3878641..3879260 Replicon chromosome
Accession NZ_CP110523
Organism Klebsiella pneumoniae strain WS_29-2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OM422_RS19050 Protein ID WP_002892050.1
Coordinates 3879042..3879260 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OM422_RS19045 Protein ID WP_002892066.1
Coordinates 3878641..3879015 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM422_RS19035 (3873793) 3873793..3874986 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OM422_RS19040 (3875009) 3875009..3878155 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OM422_RS19045 (3878641) 3878641..3879015 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OM422_RS19050 (3879042) 3879042..3879260 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OM422_RS19055 (3879419) 3879419..3879985 + 567 WP_002892030.1 maltose O-acetyltransferase -
OM422_RS19060 (3879957) 3879957..3880097 - 141 WP_004147370.1 hypothetical protein -
OM422_RS19065 (3880118) 3880118..3880588 + 471 WP_002892026.1 YlaC family protein -
OM422_RS19070 (3880563) 3880563..3882014 - 1452 WP_009307955.1 PLP-dependent aminotransferase family protein -
OM422_RS19075 (3882115) 3882115..3882813 + 699 WP_004177238.1 GNAT family protein -
OM422_RS19080 (3882810) 3882810..3882950 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OM422_RS19085 (3882950) 3882950..3883213 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263901 WP_002892050.1 NZ_CP110523:3879042-3879260 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263901 WP_002892066.1 NZ_CP110523:3878641-3879015 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References