Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 19989..20632 | Replicon | plasmid pRWS291.s3 |
Accession | NZ_CP110517 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OM421_RS28555 | Protein ID | WP_001044770.1 |
Coordinates | 20216..20632 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OM421_RS28550 | Protein ID | WP_001261282.1 |
Coordinates | 19989..20219 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS28530 (OM421_28520) | 16054..17427 | + | 1374 | WP_004206605.1 | hypothetical protein | - |
OM421_RS28535 (OM421_28525) | 17612..18940 | + | 1329 | WP_004206607.1 | nucleotidyltransferase | - |
OM421_RS28540 (OM421_28530) | 18948..19523 | + | 576 | WP_004206608.1 | SLATT domain-containing protein | - |
OM421_RS28545 (OM421_28535) | 19790..20032 | - | 243 | Protein_17 | hypothetical protein | - |
OM421_RS28550 (OM421_28540) | 19989..20219 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OM421_RS28555 (OM421_28545) | 20216..20632 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OM421_RS28560 (OM421_28550) | 20706..22268 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
OM421_RS28565 (OM421_28555) | 22253..23275 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
OM421_RS28570 (OM421_28560) | 23819..24727 | + | 909 | WP_032426221.1 | HNH endonuclease | - |
OM421_RS28575 (OM421_28565) | 24913..25263 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..212886 | 212886 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T263888 WP_001044770.1 NZ_CP110517:20216-20632 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |