Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 234824..235346 | Replicon | plasmid pRWS291.s1 |
Accession | NZ_CP110515 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | OM421_RS26690 | Protein ID | WP_004181778.1 |
Coordinates | 235062..235346 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | OM421_RS26685 | Protein ID | WP_004181777.1 |
Coordinates | 234824..235072 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS26665 (OM421_26655) | 230033..230854 | - | 822 | WP_004181772.1 | hypothetical protein | - |
OM421_RS26670 (OM421_26660) | 230916..231269 | - | 354 | WP_004181774.1 | hypothetical protein | - |
OM421_RS26675 (OM421_26665) | 231414..232400 | - | 987 | WP_040120328.1 | hypothetical protein | - |
OM421_RS26680 (OM421_26670) | 232734..234533 | - | 1800 | WP_038991636.1 | ATP-dependent helicase | - |
OM421_RS26685 (OM421_26675) | 234824..235072 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OM421_RS26690 (OM421_26680) | 235062..235346 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM421_RS26695 (OM421_26685) | 235363..235464 | - | 102 | Protein_263 | IS200/IS605 family transposase | - |
OM421_RS26700 (OM421_26690) | 235500..236723 | + | 1224 | WP_004181779.1 | RNA-guided endonuclease TnpB family protein | - |
OM421_RS26705 (OM421_26695) | 237114..238301 | - | 1188 | WP_277696569.1 | RNA-guided endonuclease TnpB family protein | - |
OM421_RS26710 (OM421_26700) | 238967..239434 | + | 468 | WP_124737156.1 | hypothetical protein | - |
OM421_RS26715 (OM421_26705) | 239479..239685 | - | 207 | WP_063938351.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..361178 | 361178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T263886 WP_004181778.1 NZ_CP110515:235062-235346 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |