Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 207738..208489 | Replicon | plasmid pRWS291.s1 |
Accession | NZ_CP110515 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | OM421_RS26525 | Protein ID | WP_016946197.1 |
Coordinates | 207738..208220 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | OM421_RS26530 | Protein ID | WP_004902250.1 |
Coordinates | 208211..208489 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS26505 (OM421_26495) | 203281..203607 | - | 327 | Protein_225 | IS1 family transposase | - |
OM421_RS26510 (OM421_26500) | 203641..204246 | - | 606 | WP_000509966.1 | recombinase family protein | - |
OM421_RS26515 (OM421_26505) | 204341..207238 | + | 2898 | WP_001553819.1 | Tn3-like element Tn5403 family transposase | - |
OM421_RS26520 (OM421_26510) | 207274..207647 | - | 374 | Protein_228 | IS1 family transposase | - |
OM421_RS26525 (OM421_26515) | 207738..208220 | - | 483 | WP_016946197.1 | GNAT family N-acetyltransferase | Toxin |
OM421_RS26530 (OM421_26520) | 208211..208489 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
OM421_RS26535 (OM421_26525) | 208611..208823 | - | 213 | WP_016946198.1 | hypothetical protein | - |
OM421_RS26540 (OM421_26530) | 208931..209272 | - | 342 | WP_032437747.1 | hypothetical protein | - |
OM421_RS26545 (OM421_26535) | 209946..210149 | + | 204 | WP_080466101.1 | hypothetical protein | - |
OM421_RS26550 (OM421_26540) | 210179..210493 | + | 315 | WP_065800137.1 | hypothetical protein | - |
OM421_RS26555 (OM421_26545) | 210737..211219 | - | 483 | WP_169510637.1 | hypothetical protein | - |
OM421_RS26560 (OM421_26550) | 212447..213331 | + | 885 | WP_004186900.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..361178 | 361178 | |
- | inside | IScluster/Tn | - | - | 187012..207647 | 20635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17724.53 Da Isoelectric Point: 8.9130
>T263885 WP_016946197.1 NZ_CP110515:c208220-207738 [Klebsiella pneumoniae]
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLMSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|