Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 123254..123897 | Replicon | plasmid pRWS291.s1 |
Accession | NZ_CP110515 | ||
Organism | Klebsiella pneumoniae strain WS_29-1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A5P6KDG5 |
Locus tag | OM421_RS26050 | Protein ID | WP_021312768.1 |
Coordinates | 123254..123670 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A5P6KGW8 |
Locus tag | OM421_RS26055 | Protein ID | WP_021312767.1 |
Coordinates | 123667..123897 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM421_RS26030 (OM421_26020) | 119554..120018 | + | 465 | WP_001243598.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
OM421_RS26035 (OM421_26025) | 120298..120822 | - | 525 | Protein_131 | IS5-like element ISKpn26 family transposase | - |
OM421_RS26040 (OM421_26030) | 120858..122297 | - | 1440 | Protein_132 | IS66 family transposase | - |
OM421_RS26045 (OM421_26035) | 122362..123066 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
OM421_RS26050 (OM421_26040) | 123254..123670 | - | 417 | WP_021312768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OM421_RS26055 (OM421_26045) | 123667..123897 | - | 231 | WP_021312767.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OM421_RS26060 (OM421_26050) | 124687..125610 | - | 924 | WP_040120127.1 | IS5 family transposase | - |
OM421_RS26065 (OM421_26055) | 125689..126456 | + | 768 | Protein_137 | sugar-binding domain-containing protein | - |
OM421_RS26070 (OM421_26060) | 126893..127651 | + | 759 | WP_040120128.1 | 3-oxoacyl-ACP reductase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..361178 | 361178 | |
- | inside | IScluster/Tn | - | - | 120298..125610 | 5312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15175.60 Da Isoelectric Point: 7.2452
>T263881 WP_021312768.1 NZ_CP110515:c123670-123254 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5P6KDG5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5P6KGW8 |