Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4595827..4596343 | Replicon | chromosome |
| Accession | NZ_CP110514 | ||
| Organism | Klebsiella pneumoniae strain WS_29-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | OM421_RS22530 | Protein ID | WP_004178374.1 |
| Coordinates | 4595827..4596111 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | OM421_RS22535 | Protein ID | WP_002886901.1 |
| Coordinates | 4596101..4596343 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM421_RS22505 (4591243) | 4591243..4591506 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
| OM421_RS22510 (4591636) | 4591636..4591809 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| OM421_RS22515 (4591812) | 4591812..4592555 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| OM421_RS22520 (4592912) | 4592912..4595050 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OM421_RS22525 (4595359) | 4595359..4595823 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OM421_RS22530 (4595827) | 4595827..4596111 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM421_RS22535 (4596101) | 4596101..4596343 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OM421_RS22540 (4596421) | 4596421..4598331 | - | 1911 | WP_032421964.1 | PRD domain-containing protein | - |
| OM421_RS22545 (4598354) | 4598354..4599508 | - | 1155 | WP_032421963.1 | lactonase family protein | - |
| OM421_RS22550 (4599575) | 4599575..4600315 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T263876 WP_004178374.1 NZ_CP110514:c4596111-4595827 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |