Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3880686..3881305 | Replicon | chromosome |
| Accession | NZ_CP110514 | ||
| Organism | Klebsiella pneumoniae strain WS_29-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OM421_RS19075 | Protein ID | WP_002892050.1 |
| Coordinates | 3881087..3881305 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OM421_RS19070 | Protein ID | WP_002892066.1 |
| Coordinates | 3880686..3881060 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM421_RS19060 (3875838) | 3875838..3877031 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OM421_RS19065 (3877054) | 3877054..3880200 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OM421_RS19070 (3880686) | 3880686..3881060 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OM421_RS19075 (3881087) | 3881087..3881305 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OM421_RS19080 (3881464) | 3881464..3882030 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OM421_RS19085 (3882002) | 3882002..3882142 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OM421_RS19090 (3882163) | 3882163..3882633 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OM421_RS19095 (3882608) | 3882608..3884059 | - | 1452 | WP_009307955.1 | PLP-dependent aminotransferase family protein | - |
| OM421_RS19100 (3884160) | 3884160..3884858 | + | 699 | WP_004177238.1 | GNAT family protein | - |
| OM421_RS19105 (3884855) | 3884855..3884995 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OM421_RS19110 (3884995) | 3884995..3885258 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263874 WP_002892050.1 NZ_CP110514:3881087-3881305 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263874 WP_002892066.1 NZ_CP110514:3880686-3881060 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |