Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3880686..3881305 Replicon chromosome
Accession NZ_CP110514
Organism Klebsiella pneumoniae strain WS_29-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OM421_RS19075 Protein ID WP_002892050.1
Coordinates 3881087..3881305 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OM421_RS19070 Protein ID WP_002892066.1
Coordinates 3880686..3881060 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM421_RS19060 (3875838) 3875838..3877031 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OM421_RS19065 (3877054) 3877054..3880200 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OM421_RS19070 (3880686) 3880686..3881060 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OM421_RS19075 (3881087) 3881087..3881305 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OM421_RS19080 (3881464) 3881464..3882030 + 567 WP_002892030.1 maltose O-acetyltransferase -
OM421_RS19085 (3882002) 3882002..3882142 - 141 WP_004147370.1 hypothetical protein -
OM421_RS19090 (3882163) 3882163..3882633 + 471 WP_002892026.1 YlaC family protein -
OM421_RS19095 (3882608) 3882608..3884059 - 1452 WP_009307955.1 PLP-dependent aminotransferase family protein -
OM421_RS19100 (3884160) 3884160..3884858 + 699 WP_004177238.1 GNAT family protein -
OM421_RS19105 (3884855) 3884855..3884995 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OM421_RS19110 (3884995) 3884995..3885258 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263874 WP_002892050.1 NZ_CP110514:3881087-3881305 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263874 WP_002892066.1 NZ_CP110514:3880686-3881060 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References