Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 11997..12598 Replicon plasmid pRWS531
Accession NZ_CP110512
Organism Escherichia coli strain ws5-3

Toxin (Protein)


Gene name doc Uniprot ID Q47172
Locus tag OM087_RS23240 Protein ID WP_001694510.1
Coordinates 12218..12598 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag OM087_RS23235 Protein ID WP_001190712.1
Coordinates 11997..12218 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM087_RS23225 (OM087_23135) 9017..10261 - 1245 WP_113453400.1 restriction endonuclease subunit S -
OM087_RS23230 (OM087_23140) 10258..11814 - 1557 WP_113453401.1 type I restriction-modification system subunit M -
OM087_RS23235 (OM087_23145) 11997..12218 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OM087_RS23240 (OM087_23150) 12218..12598 + 381 WP_001694510.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OM087_RS23245 (OM087_23155) 12603..12782 + 180 WP_113453402.1 PdcA protein -
OM087_RS23250 (OM087_23160) 12810..13853 + 1044 WP_032313385.1 DUF968 domain-containing protein -
OM087_RS23255 (OM087_23165) 14081..14149 + 69 Protein_15 phage antirepressor Ant -
OM087_RS23260 (OM087_23170) 14182..15033 - 852 WP_000611656.1 phage repressor protein C1 -
OM087_RS23265 (OM087_23175) 15144..15353 - 210 WP_000874154.1 hypothetical protein -
OM087_RS23270 (OM087_23180) 15959..16180 + 222 WP_113453376.1 creatininase -
OM087_RS23275 (OM087_23185) 16188..17219 + 1032 WP_053896055.1 site-specific integrase -
OM087_RS23280 (OM087_23190) 17270..17581 + 312 WP_001224234.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / qnrS1 / dfrA14 / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / floR - 1..118422 118422


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13616.35 Da        Isoelectric Point: 5.1514

>T263858 WP_001694510.1 NZ_CP110512:12218-12598 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT263858 WP_001190712.1 NZ_CP110512:11997-12218 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A737M8C8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References