Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4358292..4358917 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | OM087_RS20950 | Protein ID | WP_000911329.1 |
| Coordinates | 4358519..4358917 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | OM087_RS20945 | Protein ID | WP_000450524.1 |
| Coordinates | 4358292..4358519 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS20920 (4354094) | 4354094..4354564 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| OM087_RS20925 (4354564) | 4354564..4355136 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| OM087_RS20930 (4355282) | 4355282..4356160 | + | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| OM087_RS20935 (4356177) | 4356177..4357211 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| OM087_RS20940 (4357424) | 4357424..4358137 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| OM087_RS20945 (4358292) | 4358292..4358519 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| OM087_RS20950 (4358519) | 4358519..4358917 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM087_RS20955 (4359064) | 4359064..4359927 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| OM087_RS20960 (4359942) | 4359942..4361957 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| OM087_RS20965 (4362031) | 4362031..4362729 | + | 699 | WP_000679812.1 | esterase | - |
| OM087_RS20970 (4362810) | 4362810..4363010 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T263857 WP_000911329.1 NZ_CP110511:4358519-4358917 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |