Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4062874..4063457 | Replicon | chromosome |
Accession | NZ_CP110511 | ||
Organism | Escherichia coli strain ws5-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | OM087_RS19535 | Protein ID | WP_000254745.1 |
Coordinates | 4063122..4063457 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2J1DJJ7 |
Locus tag | OM087_RS19530 | Protein ID | WP_000581939.1 |
Coordinates | 4062874..4063122 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM087_RS19520 (4059213) | 4059213..4060514 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
OM087_RS19525 (4060562) | 4060562..4062796 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
OM087_RS19530 (4062874) | 4062874..4063122 | + | 249 | WP_000581939.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OM087_RS19535 (4063122) | 4063122..4063457 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
OM087_RS19540 (4063528) | 4063528..4064319 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OM087_RS19545 (4064547) | 4064547..4066184 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OM087_RS19550 (4066272) | 4066272..4067570 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T263856 WP_000254745.1 NZ_CP110511:4063122-4063457 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J1DJJ7 |