Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3927567..3928221 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | OM087_RS18925 | Protein ID | WP_000244781.1 |
| Coordinates | 3927814..3928221 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | OM087_RS18920 | Protein ID | WP_000354046.1 |
| Coordinates | 3927567..3927833 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS18895 (3922850) | 3922850..3923593 | + | 744 | WP_115724079.1 | SDR family oxidoreductase | - |
| OM087_RS18900 (3923655) | 3923655..3925088 | - | 1434 | WP_162822830.1 | 6-phospho-beta-glucosidase BglA | - |
| OM087_RS18905 (3925133) | 3925133..3925444 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| OM087_RS18910 (3925608) | 3925608..3926267 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| OM087_RS18915 (3926344) | 3926344..3927324 | - | 981 | WP_000886074.1 | tRNA-modifying protein YgfZ | - |
| OM087_RS18920 (3927567) | 3927567..3927833 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| OM087_RS18925 (3927814) | 3927814..3928221 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| OM087_RS18930 (3928261) | 3928261..3928782 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| OM087_RS18935 (3928894) | 3928894..3929790 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| OM087_RS18940 (3929815) | 3929815..3930525 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OM087_RS18945 (3930531) | 3930531..3932264 | + | 1734 | WP_115724081.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T263855 WP_000244781.1 NZ_CP110511:3927814-3928221 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|