Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 2397358..2398065 Replicon chromosome
Accession NZ_CP110511
Organism Escherichia coli strain ws5-3

Toxin (Protein)


Gene name ykfI Uniprot ID A0A4T3Q6D2
Locus tag OM087_RS11515 Protein ID WP_001683515.1
Coordinates 2397358..2397699 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OM087_RS11520 Protein ID WP_097470378.1
Coordinates 2397730..2398065 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM087_RS11485 (2392636) 2392636..2393979 + 1344 WP_000504877.1 McrC family protein -
OM087_RS11490 (2393976) 2393976..2394362 + 387 WP_000148644.1 hypothetical protein -
OM087_RS11495 (2394475) 2394475..2395637 + 1163 WP_085947598.1 IS3-like element IS3 family transposase -
OM087_RS11500 (2395806) 2395806..2396081 - 276 WP_001683517.1 type II toxin-antitoxin system RelE/ParE family toxin -
OM087_RS11505 (2396085) 2396085..2396333 - 249 WP_000535212.1 ribbon-helix-helix domain-containing protein -
OM087_RS11510 (2396410) 2396410..2397243 - 834 WP_097470379.1 DUF4942 domain-containing protein -
OM087_RS11515 (2397358) 2397358..2397699 - 342 WP_001683515.1 TA system toxin CbtA family protein Toxin
OM087_RS11520 (2397730) 2397730..2398065 - 336 WP_097470378.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OM087_RS11525 (2398065) 2398065..2398538 - 474 WP_097470377.1 DNA repair protein RadC -
OM087_RS11530 (2398568) 2398568..2399386 - 819 WP_097470376.1 DUF932 domain-containing protein -
OM087_RS11535 (2399622) 2399622..2400575 - 954 WP_032218964.1 hypothetical protein -
OM087_RS11540 (2401168) 2401168..2401782 + 615 WP_115723908.1 inovirus Gp2 family protein -
OM087_RS11545 (2401900) 2401900..2402118 + 219 WP_001064742.1 AlpA family phage regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimE / fimB 2383295..2414845 31550


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-110)

Antitoxin

Antitoxin CbeA

(10-110)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13034.05 Da        Isoelectric Point: 9.5454

>T263849 WP_001683515.1 NZ_CP110511:c2397699-2397358 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCHNTTAR

Download         Length: 342 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12570.58 Da        Isoelectric Point: 7.6977

>AT263849 WP_097470378.1 NZ_CP110511:c2398065-2397730 [Escherichia coli]
MLQKDKVMQQEWGLPCTVTPRFTARLVQERHNLHYLADRAAITGKFSSPDLLHIDQAFPVLMKQLELKLADGELSPCQQR
TITLYAKGLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4T3Q6D2

Antitoxin

Source ID Structure

References