Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1787197..1788034 | Replicon | chromosome |
Accession | NZ_CP110511 | ||
Organism | Escherichia coli strain ws5-3 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | OM087_RS08640 | Protein ID | WP_000227784.1 |
Coordinates | 1787492..1788034 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | OM087_RS08635 | Protein ID | WP_001297137.1 |
Coordinates | 1787197..1787508 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM087_RS08610 (1782217) | 1782217..1783164 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
OM087_RS08615 (1783186) | 1783186..1785177 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
OM087_RS08620 (1785167) | 1785167..1785781 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
OM087_RS08625 (1785781) | 1785781..1786110 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
OM087_RS08630 (1786122) | 1786122..1787012 | + | 891 | WP_000971336.1 | heme o synthase | - |
OM087_RS08635 (1787197) | 1787197..1787508 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
OM087_RS08640 (1787492) | 1787492..1788034 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
OM087_RS08645 (1788090) | 1788090..1789025 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
OM087_RS08650 (1789433) | 1789433..1790797 | + | 1365 | WP_001000978.1 | MFS transporter | - |
OM087_RS08655 (1790925) | 1790925..1791416 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
OM087_RS08660 (1791584) | 1791584..1792495 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T263846 WP_000227784.1 NZ_CP110511:1787492-1788034 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|