Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1753108..1753726 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | OM087_RS08470 | Protein ID | WP_001291435.1 |
| Coordinates | 1753508..1753726 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | OM087_RS08465 | Protein ID | WP_000344800.1 |
| Coordinates | 1753108..1753482 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS08455 (1748197) | 1748197..1749390 | + | 1194 | WP_277716277.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OM087_RS08460 (1749413) | 1749413..1752562 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| OM087_RS08465 (1753108) | 1753108..1753482 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| OM087_RS08470 (1753508) | 1753508..1753726 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| OM087_RS08475 (1753898) | 1753898..1754449 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| OM087_RS08480 (1754565) | 1754565..1755035 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| OM087_RS08485 (1755199) | 1755199..1756749 | + | 1551 | WP_115724151.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| OM087_RS08490 (1756791) | 1756791..1757144 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| OM087_RS08500 (1757522) | 1757522..1757833 | + | 312 | WP_162822834.1 | MGMT family protein | - |
| OM087_RS08505 (1757864) | 1757864..1758436 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263845 WP_001291435.1 NZ_CP110511:1753508-1753726 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT263845 WP_000344800.1 NZ_CP110511:1753108-1753482 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |