Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 706013..706651 | Replicon | chromosome |
| Accession | NZ_CP110511 | ||
| Organism | Escherichia coli strain ws5-3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | OM087_RS03485 | Protein ID | WP_000813794.1 |
| Coordinates | 706475..706651 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OM087_RS03480 | Protein ID | WP_001270286.1 |
| Coordinates | 706013..706429 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM087_RS03460 (701165) | 701165..702106 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| OM087_RS03465 (702107) | 702107..703120 | - | 1014 | WP_115724346.1 | ABC transporter ATP-binding protein | - |
| OM087_RS03470 (703138) | 703138..704283 | - | 1146 | WP_000047430.1 | ABC transporter substrate-binding protein | - |
| OM087_RS03475 (704528) | 704528..705934 | - | 1407 | WP_087899278.1 | PLP-dependent aminotransferase family protein | - |
| OM087_RS03480 (706013) | 706013..706429 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| OM087_RS03485 (706475) | 706475..706651 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| OM087_RS03490 (706873) | 706873..707103 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| OM087_RS03495 (707195) | 707195..709156 | - | 1962 | WP_001515270.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| OM087_RS03500 (709229) | 709229..709765 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| OM087_RS03505 (709857) | 709857..711032 | + | 1176 | WP_248789728.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 711072..712220 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T263844 WP_000813794.1 NZ_CP110511:c706651-706475 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT263844 WP_001270286.1 NZ_CP110511:c706429-706013 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|