Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 2314476..2315109 | Replicon | chromosome |
Accession | NZ_CP110483 | ||
Organism | Weizmannia coagulans strain XY2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G2TIM0 |
Locus tag | ONG97_RS11625 | Protein ID | WP_013860680.1 |
Coordinates | 2314759..2315109 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | G2TIL9 |
Locus tag | ONG97_RS11620 | Protein ID | WP_014096808.1 |
Coordinates | 2314476..2314754 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONG97_RS11600 (ONG97_11600) | 2310589..2311188 | - | 600 | WP_019720980.1 | rhomboid family intramembrane serine protease | - |
ONG97_RS11605 (ONG97_11605) | 2311463..2311813 | + | 351 | WP_133536150.1 | holo-ACP synthase | - |
ONG97_RS11610 (ONG97_11610) | 2311954..2312970 | + | 1017 | WP_265114672.1 | outer membrane lipoprotein carrier protein LolA | - |
ONG97_RS11615 (ONG97_11615) | 2313172..2314323 | + | 1152 | WP_265114673.1 | alanine racemase | - |
ONG97_RS11620 (ONG97_11620) | 2314476..2314754 | + | 279 | WP_014096808.1 | hypothetical protein | Antitoxin |
ONG97_RS11625 (ONG97_11625) | 2314759..2315109 | + | 351 | WP_013860680.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ONG97_RS11630 (ONG97_11630) | 2315591..2316418 | + | 828 | WP_265114674.1 | RsbT co-antagonist protein RsbRA | - |
ONG97_RS11635 (ONG97_11635) | 2316422..2316778 | + | 357 | WP_017553290.1 | STAS domain-containing protein | - |
ONG97_RS11640 (ONG97_11640) | 2316783..2317184 | + | 402 | WP_013860676.1 | anti-sigma regulatory factor | - |
ONG97_RS11645 (ONG97_11645) | 2317199..2318242 | + | 1044 | Protein_2287 | PP2C family protein-serine/threonine phosphatase | - |
ONG97_RS11650 (ONG97_11650) | 2318279..2318608 | + | 330 | WP_013860674.1 | anti-sigma factor antagonist | - |
ONG97_RS11655 (ONG97_11655) | 2318612..2319082 | + | 471 | WP_265114675.1 | anti-sigma B factor RsbW | - |
ONG97_RS11660 (ONG97_11660) | 2319060..2319839 | + | 780 | WP_265114676.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12968.01 Da Isoelectric Point: 4.8998
>T263839 WP_013860680.1 NZ_CP110483:2314759-2315109 [Weizmannia coagulans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4BYJ0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4BX66 |