Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2950606..2951223 Replicon chromosome
Accession NZ_CP110473
Organism Pantoea anthophila strain CL1

Toxin (Protein)


Gene name Hha Uniprot ID E0LTU7
Locus tag OJ965_RS16345 Protein ID WP_003850458.1
Coordinates 2951008..2951223 (+) Length 72 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A855YWA6
Locus tag OJ965_RS16340 Protein ID WP_046101364.1
Coordinates 2950606..2950983 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ965_RS16310 (OJ965_16305) 2946915..2947169 + 255 WP_009091662.1 type B 50S ribosomal protein L31 -
OJ965_RS16315 (OJ965_16310) 2947181..2947321 + 141 WP_009091664.1 type B 50S ribosomal protein L36 -
OJ965_RS16320 (OJ965_16315) 2947367..2948245 - 879 WP_150029367.1 metal ABC transporter substrate-binding protein -
OJ965_RS16325 (OJ965_16320) 2948261..2949100 - 840 WP_009091667.1 metal ABC transporter permease -
OJ965_RS16330 (OJ965_16325) 2949097..2949765 - 669 WP_167431160.1 ABC transporter ATP-binding protein -
OJ965_RS16335 (OJ965_16330) 2950105..2950458 + 354 WP_009091670.1 hypothetical protein -
OJ965_RS16340 (OJ965_16335) 2950606..2950983 + 378 WP_046101364.1 Hha toxicity modulator TomB Antitoxin
OJ965_RS16345 (OJ965_16340) 2951008..2951223 + 216 WP_003850458.1 HHA domain-containing protein Toxin
OJ965_RS16355 (OJ965_16350) 2951634..2951951 + 318 WP_058956360.1 MGMT family protein -
OJ965_RS16360 (OJ965_16355) 2951985..2952542 - 558 WP_058956361.1 YbaY family lipoprotein -
OJ965_RS16365 (OJ965_16360) 2952733..2953596 + 864 WP_058956362.1 acyl-CoA thioesterase II -
OJ965_RS16370 (OJ965_16365) 2953645..2954931 - 1287 WP_009091680.1 ammonium transporter AmtB -
OJ965_RS16375 (OJ965_16370) 2954966..2955304 - 339 WP_003850469.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(12-68)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 72 a.a.        Molecular weight: 8510.90 Da        Isoelectric Point: 9.4825

>T263837 WP_003850458.1 NZ_CP110473:2951008-2951223 [Pantoea anthophila]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 216 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14686.32 Da        Isoelectric Point: 4.5014

>AT263837 WP_046101364.1 NZ_CP110473:2950606-2950983 [Pantoea anthophila]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLHLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGINNPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I5AGC3

Antitoxin

Source ID Structure
AlphaFold DB A0A855YWA6

References